PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0118s0310.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1396aa    MW: 157083 Da    PI: 5.6328
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0118s0310.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-172682157
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            ++kR   +++qle+Le+ +  + yps+  r+eL+ +lgL++rq ++WF+ rR k++k
  SapurV1A.0118s0310.3.p 26 KSKRKMKSASQLEILEKIYSVDTYPSEVVRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                            67999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-161482IPR009057Homeodomain-like
SuperFamilySSF466892.52E-152082IPR009057Homeodomain-like
PROSITE profilePS5007116.2442383IPR001356Homeobox domain
SMARTSM003898.9E-152587IPR001356Homeobox domain
PfamPF000463.9E-152682IPR001356Homeobox domain
CDDcd000864.67E-132682No hitNo description
PROSITE profilePS5082717.101556615IPR018501DDT domain
SMARTSM005711.0E-21556615IPR018501DDT domain
PfamPF027911.5E-17557612IPR018501DDT domain
PfamPF050661.2E-15738806IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.0E-9952993IPR028942WHIM1 domain
PfamPF156134.1E-1411311203IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1396 aa     Download sequence    Send to blast
MEEAAADGGG VEVEAKNKTP GEGESKSKRK MKSASQLEIL EKIYSVDTYP SEVVRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKAPSVKRPC KESPSLAGMP SGGETGVVAE VGNEHGSGSS  120
PFVLGVDPRR AVGRPTGVAV PRISADVQTM NRYYEPQQSI AELRAIAFVE AQLGEPLRED  180
GPILGMEFDP LPPDAFGAPI GSATTGQQKQ PVRVFEANLY ERPDVKPIKS TTRTLHEYQF  240
LPQLPTVRAE AYERAAPSCQ YGSPADGHNV KTGSISATLP FMHANEQVSS EYGLSNQVPS  300
LSLMPQESRQ GHRFPSTTEY ETVLQKCSFT NIGMDVQSGA HLVTALDNPC MSSDRRVTHD  360
EDALRMERKR KSEEARIARE VEAHEKRIRK ELEKQDILRR RREEQMRKEM EKHDRERRKE  420
EERLLREKQR EVERYQREQR RELERREKYL QKESIRVEKM RQKEELRREK EAARQKAATE  480
RARARRMAKE SLELIDDERL ELMEVAASSK GLPSIIPLDF ETLQNLDLFR DKLTEFPPKS  540
VLLKRPFLIQ PWNDSEENVG NLLMVWRFLI TFADILGIWP FTLDEFVQAF HDYDPRLLSE  600
IHVSLLKSII KDIEDVARTP STGLGQNQNG AANPGGGHPQ IVEGAYAWGF DLRSWQRHLN  660
PLTWPEILRQ FGLSAGFGPQ LKKRNVDQAY LRDDNEGNDG EDVITNLRNG AAVENAVSIM  720
QERGFSNPRR SRHRLTPGTV KFAAFHVLSL EGSKGLTILE VADKIQKSGL RDLTTSKTPE  780
ASIAAALSRD SKLFERTAPS TYCVRQAYRK DPADADAILS AAKERIRTFK SGIVDGEDAD  840
DAERDEDSES DVAEDPEIDD LGTGLNSKKE AHDSPENEFN GKTILGNGTE SGGALKTPQV  900
RLENVRAGLN SQHSEDTNEL KGAGSSIDGS VDVAEICTIP DQDVGIDVSN PGEPWVQGLV  960
EGEYSDLSVE ERLNALVALI GVAIEGNSIR VALEERLEAA NALKKQMWAE AQLDKRRMKE  1020
EFVMRTQYSS STGNKMEPDL TVSATDPMVS VDERSIGMPV NAFVQQEQLS DRQIDMNYLN  1080
NMPFEGNMQM QDLSSGPDNL PYQQAGHIAE KSRSQLKSVI GHRAEEMYVY RSLPLGQDRR  1140
RNRYWQFTTS TSHNDPGCGR IFVELHDGRW RLIDSEEGFD TLLSSLDVRG VRESHLHAML  1200
QKIEVPFKET IRRRMLRANT EGQIKDLIKA EAVEMAAGPE SGTGMDSPRS TVCVPDSDMS  1260
ETSTSFTIEL GRNEIEKNHT LKRLQDFEKW MWKECFKSPV LCAMKYEKKR CTQLLGVCDY  1320
CHDTYFFEDS HCPSCHKTLE ASQTGLNFSE HVAYCERKLK MDPDSALCSL SFPPRIRLLK  1380
LLLALIEASA LKVMV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047700.10.0PREDICTED: uncharacterized protein LOC105141971 isoform X3
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLB9HGS00.0B9HGS0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator